PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P22640_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 182aa    MW: 20961.9 Da    PI: 9.6853
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P22640_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.11.5e-182982356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                           k++++++eq++ Le+ F +++++  e++ +LA++lgL+ +qV vWFqNrRa++k
  GSMUA_Achr1P22640_001 29 KKRRLSDEQVRFLETSFGEEKKLEFERKVHLAAELGLDPKQVAVWFQNRRARHK 82
                           45689***********************************************99 PP

2HD-ZIP_I/II118.34.3e-3829120293
            HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                            kkrrls+eqv++LE+sF ee+kLe erKv+la eLgl+p+qvavWFqnrRAR+k+kq+E+ y +Lk+ +da + e+++Le+ev +L++
  GSMUA_Achr1P22640_001  29 KKRRLSDEQVRFLETSFGEEKKLEFERKVHLAAELGLDPKQVAVWFQNRRARHKSKQVEEAYLKLKSIHDATVVEKCHLETEVLKLKD 116
                            9*************************************************************************************** PP

            HD-ZIP_I/II  90 elke 93 
                            +l+e
  GSMUA_Achr1P22640_001 117 KLHE 120
                            9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.5842484IPR001356Homeobox domain
SMARTSM003892.2E-172788IPR001356Homeobox domain
SuperFamilySSF466892.78E-172888IPR009057Homeodomain-like
CDDcd000862.65E-152985No hitNo description
Gene3DG3DSA:1.10.10.602.6E-182982IPR009057Homeodomain-like
PfamPF000466.2E-162982IPR001356Homeobox domain
PRINTSPR000318.1E-65564IPR000047Helix-turn-helix motif
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PRINTSPR000318.1E-66480IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MLVLPMVGET RVRRRRKRTK GEGAEGDAKK RRLSDEQVRF LETSFGEEKK LEFERKVHLA  60
AELGLDPKQV AVWFQNRRAR HKSKQVEEAY LKLKSIHDAT VVEKCHLETE VLKLKDKLHE  120
AEEEIRKLSL VANGGVVGGN GESAFTVETT PITEQTLYFR GSPPFMFSSY HHENLPSREK  180
DF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11017RVRRRRKR
21331RRRKRTKGEGAEGDAKKRR
31531RKRTKGEGAEGDAKKRR
47684RRARHKSKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408021.12e-90PREDICTED: homeobox-leucine zipper protein HOX12-like
SwissprotQ7XI855e-46HOX14_ORYSJ; Homeobox-leucine zipper protein HOX14
TrEMBLM0S2721e-131M0S272_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P22640_0011e-131(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-43homeobox protein 40